Quick Search

Enter gene name or accession number


Gene: ML0304

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namepknG
Accession numberML0304
TypeCDS
FunctionInvolved in signal transduction (via phosphorylation). Thought to regulate amino-acid uptake and stationary-phase metabolism. Phosphorylates the peptide substrate myelin basic protein (MBP) at serine residues [Catalytic activity: ATP + A protein = ADP + A phosphoprotein].
ProductProbable serine-threonine protein kinase PknG (protein kinase G) (STPK G)
Evidenceexperimental (In M. tuberculosis)
CommentsML0304, len: 767 aa. Probable pknG, serine/threonine-protein kinase (EC 2.7.1.-) (see citations below), highly similar to Rv0410c|P96256|AL123456 pknG, serine/threonine protein kinase from M. tuberculosis (750 aa), Fasta scores: E(): 0, (83.1% identity in 756 aa overlap). Similar to many bacterial putative serine/threonine protein kinases e.g. CAB71204|AL138538 possible protein kinase from Streptomyces coelicolor (903 aa), Fasta scores: E(): 0, (42.0% identity in 793 aa overlap). Similar in part, to protein kinases from Myxococcus xanthus e.g. Q9XBP5|AF159692 pkn12, serine/threonine protein kinase (465 aa), Fasta scores: E(): 2.9e-10, (28.4% identity in 292 aa overlap). Previously sequenced as Q9ZBL8|AL035159) (763 aa), Fasta scores: E(): 0, (100.0% identity in 763 aa overlap). Also similar to regions of ML0016 and ML0017 from M.leprae. Contains Pfam match to entry PF00069 pkinase, Eukaryotic protein kinase domain. Contains PS00108 Serine/Threonine protein kinases active-site signature. Belongs to the Ser/Thr family of protein kinases.
Molecular mass (Da)83888
Isoelectric point5.52
Gene length (bp)2304
Protein length768
Location (kb)386.63


Functional categoryregulatory proteins


Annotation Changescoordinates updated on 11-AUG-2009


Coordinates
TypeStartEndOrientation
CDS386630388933+


Protein sequence in FASTA format
>M. leprae TN | pknG
MAESMKREHMDHDTEDVGQAAQRADPPSGTTEGRLQSTQAIFRPNFDDDDDLLHISVPSVDTEPQDRITPATRVLPPIRQ
LGGGLVEIRRVRDIDPLEALMTNPVVPESKRFCWNCGRPVGRSELEGQEADGAQGAKEGWCPYCGSPYSFLPQLSPGDIV
AGQYEVKGCIAHGGLGWVYLAFDHNVNDRPVVLKGLVHSGDAEAQASAVAERQFLAEVVHPQIVQIFNFVEHKDTSGDPV
GYIVMEYIGGRSLKRGSKKGNVEKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSF
GCIYGTPGYQAPEIVRTGPTVATDIYTVGRTLAALTLNLRTRNGRYMDGLPEDDPVLTTYDSFARLLHRAINPDPRRRFS
SAEEMSAQLMGVLREVVAQDTGVPRAGLSTIFSPSRSTFGVDLLVAHTDVYLDGRLHSEKLTAKDIVTALQVPLVDPTDV
AAPVLQATVLSQPVQTLDSLRAARHGMLDAQGIDLAESVELPLMEVRALLDLGDVVKANRKLDDLADRVSCQWRLVWYRA
VADLLTGDYASATKHFTEVLNTFPGELAPKLALAATAELAGESDEHKFYRTVWHTNDGVVSAAFGLARFQSAEGDRTGAV
CTLDEVPPTSRHFTTARLTSAVTLLSGRSTNEITEQQIRDAARRVETLPPTEPRVLQIRALVLGCAMDWLADNQASANHI
LGFPFTKHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTL*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Enzyme Classification2.7.11.1
Gene Ontologyprotein serine/threonine kinase activity
ATP binding
protein amino acid phosphorylation
MtuberculosisRv0410c
UniProtP57993


Interacting Drugs/Compounds
TDR TargetsML0304