Quick Search

Enter gene name or accession number


Gene: ML0803

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameML0803
Accession numberML0803
TypeCDS
FunctionSENSOR PART OF A TWO COMPONENT REGULATORY SYSTEM.
ProductProbable two-component sensor kinase
CommentsML0803, len: 500 aa. Probable two-component sensor kinase, highly similar to Rv3220c|MTCY07D11.06|O05846|Z95120 Probable two component sensor kinase from M. tuberculosis (501 aa), fasta scores: E(): 5.1e-165, (81.8% identity in 501 aa), and CAD95338|Mb3246c from M. bovis (501 aa). Similar to others e.g. Q82IW5 Putative two-component system sensor kinase from Streptomyces avermitilis (501 aa), fasta scores: E(): 3.9e-78, (45.892% identity in 499 aa overlap). Contains Pfam match to entry PF00512 signal, Histidine kinase. SEEMS SIMILAR TO OTHER PROKARYOTIC SENSORY TRANSDUCTION HISTIDINE KINASES.
Molecular mass (Da)54104.7
Isoelectric point6.31
Gene length (bp)1503
Protein length501
Location (kb)952.105


Functional categoryregulatory proteins


Annotation Changescoordinates updated on 11-AUG-2009


Coordinates
TypeStartEndOrientation
CDS952105953607+


Protein sequence in FASTA format
>M. leprae TN | ML0803
MSTLGDLLAEHTVLPGNAVGHLHAVVGEWQLLADLSFADYLMWVSRDDGVLVCVAQCRPHTAPTVLQTDAVGSVASADML
PLVTEMFTSGAVQHEDAAGQQYSWLPFGRNVAASPVRYGDQVVAVLTQHQVELAARRRPGNLEIAYLACATDLLHMLAEG
TFPDVGDVAVSHSTPRAGDGFIRLDRNGVVAFASPNALSAFHRMGLTAELQGRNLVKVTRPLLSDPFEAQEVAKHVQDLL
DGGPSMRVEVNAGGATVLLRTLPLVVHGSSVGAAVLVRDVTEVKRRDRALISKDATIREIHHRVKNNLQTVAALLRLQAR
RMANAEGREALIESVRRVSSIALVHDALSMSVDEQVNLDEVIDRILPIMNDVASVDRPIRINRVGNLGMLDSDRATALIM
VITELVQNAIEHAFDPASQEGFVAISAERSARWLDVVVHDDGRGLPQGFNLERSDSLGLQIVRTLVSSELDGSLGMRKAP
NRGTDVVLRVPIGRRARLLL*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains Protein Family Domains Protein Family Domains


Orthologs/Cross-references
Gene Ontologytwo-component sensor activity
ATP binding
signal transduction
peptidyl-histidine phosphorylation
MtuberculosisRv3220c
UniProtQ9CCH8


Interacting Drugs/Compounds
TDR TargetsML0803