Quick Search

Enter gene name or accession number


Gene: ML0883

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nametrpD
Accession numberML0883
TypeCDS
Functiontryptophan biosynthesis [Catalytic activity: Anthranilate + phosphoribosyldiphosphate = N-5'-phosphoribosyl-anthranilate + diphosphate].
ProductProbable anthranilate phosphoribosyltransferase TrpD
Evidenceexperimental (in M. tuberculosis)
CommentsML0883, len: 366 aa. Probable trpD, anthranilate phosphoribosyltransferase (EC 2.4.2.18). Similar to Mycobacterium tuberculosis anthranilate phosphoribosyltransferase trpD or Rv2192c or MTCY190.03C SW:TRPD_MYCTU (Q10382) (370 aa) fasta scores: E(): 0, 80.1% identity in 362 aa. Similar to many e.g. Streptomyces coelicolor anthranilate phosphoribosyltransferase 1 trpD1 or SC6G10.20C SW:TRD1_STRCO (O68608) (354 aa) fasta scores: E(): 0, 48.8% identity in 363 aa. Previously sequenced as SW:TRPD_MYCLE (O69581). Contains Pfam match to entry PF00591 Glycos_transf_3, glycosyl transferase family.
Molecular mass (Da)37675.7
Isoelectric point5.63
Gene length (bp)1101
Protein length367
Location (kb)1047.67


Functional categoryintermediary metabolism and respiration


Annotation Changescoordinates updated on 11-AUG-2009


Coordinates
TypeStartEndOrientation
CDS10476671048767+


Protein sequence in FASTA format
>M. leprae TN | trpD
VVLSSQPPSSRSATGSVLSWPQVLGRLTAGQDLTRGQAAWAMGQVMTGNARPAQIAAFAVAMKMKVPTAAEVSELADVML
SHARKLPTEAICQDIGETVDIAGTGGDGANTVNLSTMAAIVVAAAGVPVVKHGNRASSSLSGGADTLEALGVRIDLGPEQ
VANSLAEIGIGFCFAPLFQPSYRYASAVRHEIGVPTVFNILGPLTNPAWPRAGLIGCAFGNLAEVMAGVFAARRSSVLVV
HGDDGLDELTTTTTSTIWRVQAGTVDKLTFDPVEFGFARAHLDDLLGGDAQTNAAKVRAVLAGAKGPVRDAVVLNAAGAI
VAYAGLSSHAEWSPAWDDGLARASAAIDSGAAEQLLARWVRFSQQV*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains Protein Family Domains


Orthologs/Cross-references
Enzyme Classification2.4.2.18
Gene Ontologytryptophan biosynthetic process
anthranilate phosphoribosyltransferase activity
MtuberculosisRv2192c
UniProtO69581


Interacting Drugs/Compounds
TDR TargetsML0883