Quick Search

Enter gene name or accession number


Gene: ML1257

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namehisD
Accession numberML1257
TypeCDS
FunctionInvolved in histidine biosynthesis pathway (last step). THIS PROTEIN IS CONSIDERED AS A BIFUNCTIONAL ENZYME, POSSESSING TWO ACTIVE SITES, ONE AN ALCOHOL DEHYDROGENASE AND THE OTHER AN ALDEHYDE DEHYDROGENASE [CATALYTIC ACTIVITY : L-HISTIDINOL + 2 NAD(+) + H(2)O = L-HISTIDINE + 2 NADH].
ProductProbable histidinol dehydrogenase HisD (HDH)
Evidenceexperimental (in M. tuberculosis)
CommentsML1257, len: 449 aa. Probable hisD, histidinol dehydrogenase (EC 1.1.1.23). Highly similar to many histidinol dehydrogenases constituting the first stage in the histidine biosynthetic pathway e.g. Mycobacterium tuberculosis Rv1599 SW:HISX_MYCTU (Z95586) (438 aa), Fasta scores: E(): 0, 84.8% identity in 442 aa overlap and Mycobacterium smegmatis SW:HISX_MYCSM (P28736) (445 aa), Fasta scores: E(): 0, 77.5% identity in 449 aa overlap. Contains Pfam match to entry PF00815 Histidinol_dh, Histidinol dehydrogenase. Contains PS00611 Histidinol dehydrogenase signature. Belongs to the histidinol dehydrogenase family.
Molecular mass (Da)46796.2
Isoelectric point5.39
Gene length (bp)1350
Protein length450
Location (kb)1502.3


Functional categoryintermediary metabolism and respiration


Annotation Changescoordinates updated on 11-AUG-2009


Coordinates
TypeStartEndOrientation
CDS15023001503649+


Protein sequence in FASTA format
>M. leprae TN | hisD
VSITPPFLLACIDLRGAELTATQLRATLPRGGADVEAVLPTVWPIVQAVAECGADAALEFGALFDGVRPPTVRVPDAALD
AALAGLDPDVRDALQVMIERTRVVHADQRRTDVTTALGPGATVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQTAGV
DSLVVASPPQFTSGGRFHGLPHPTILAAARLLGVDEVWAVGGAQAVALLAYGGTDSDDCELAPVDMITGPGNIYVTAAKR
LCRSRVGIDGEAGPTEIAILADHTADPAHVAADMISQAEHDEMAASVLVTPSTDLADATDAELAAQLRTTVHRKRVVAAL
GGRQSAIILVDDLEAGVKVVNLYAAEHLEIQTAEASRVASRIRCAGAIFVGPWAPVSLGDYCAGSNHVLPTAGFARHSGG
LSVQTFLRGIHVVNYTKTALKDISGHVITLAKAEDLPAHGEAVRRRFAR*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Enzyme Classification1.1.1.23
Gene Ontologyhistidine biosynthetic process
histidinol dehydrogenase activity
zinc ion binding
NAD or NADH binding
oxidation reduction
MtuberculosisRv1599
UniProtQ9CC57


Interacting Drugs/Compounds
TDR TargetsML1257