Quick Search

Enter gene name or accession number


Gene: ML2394

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namemetB
Accession numberML2394c
TypeCDS
FunctionINVOLVED IN METHIONINE BIOSYNTHESIS: CONVERTS O-SUCCINYL-L-HOMOSERINE TO CYSTATHIONINE [CATALYTIC ACTIVITY : O-SUCCINYL-L-HOMOSERINE + L-CYSTEINE = CYSTATHIONINE + SUCCINATE (CAN ALSO USE HYDROGEN SULFIDE AND METHANETHIOL AS SUBSTRATES)].
ProductPROBABLE CYSTATHIONINE GAMMA-SYNTHASE METB (CGS) (O-SUCCINYLHOMOSERINE [THIOL]-LYASE)
CommentsML2394c, len: 388 aa. Probable metB, cystathionine [gamma]-synthase (EC4.2.99.9 ). Similar to Mycobacterium tuberculosis cystathionine gamma-synthase Rv1079 SW:METB_MYCTU (O53427) (388 aa) fasta scores: E(): 0, 87.3% identity in 387 aa, and to Corynebacterium glutamicum cystathionine gamma-synthase MetB TR:Q9RQ97 (EMBL:AF126953) (386 aa) fasta scores: E(): 0, 61.2% id in 376 aa. Contains Pfam match to entry PF01053 Cys_Met_Meta_PP, Cys/Met metabolism PLP-dependent enzyme. Contains PS00868 Cys/Met metabolism enzymes pyridoxal-phosphate attachment site.
Molecular mass (Da)41291.8
Isoelectric point5.73
Gene length (bp)1167
Protein length389
Location (kb)2864.97


Functional categoryintermediary metabolism and respiration


Annotation Changescoordinates updated on 11-AUG-2009


Coordinates
TypeStartEndOrientation
CDS28638012864967-


Protein sequence in FASTA format
>M. leprae TN | metB
MSEDYRGHHGITGLATKAIHAGYRPDPATGAVNVPIYASSTFAQDGVGELRGGFEYARTGNPMRAALEASLATVEEGVFA
RAFSSGMAASDCALRVMLRPGDHVIIPDDVYGGTFRLIDKVFTQWNVDYTPVPLSDLDAVRAAITSRTRLIWVETPTNPL
LSIADITSIGELGKKHSVKVLVDNTFASPALQQPLMLGADVVLHSTTKYIGGHSDVVGGALVTNDEELDQAFGFLQNGAG
AVPSPFDAYLTMRGLKTLVLRMQRHNENAITVAEFLAGHPSVSAVLYPGLPSHPGHEVAARQMRGFGGMVSLRMRAGRLA
AQDLCARTKVFTLAESLGGVESLIEQPSAMTHASTTGSQLEVPDDLVRLSVGIEDVGDLLCDLKQALN*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Enzyme Classification2.5.1.48
Gene Ontologycystathionine gamma-synthase activity
cytoplasm
methionine biosynthetic process
pyridoxal phosphate binding
MtuberculosisRv1079
UniProtP46807


Interacting Drugs/Compounds
TDR TargetsML2394