Quick Search

Enter gene name or accession number


Gene: ML2430

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameproC
Accession numberML2430c
TypeCDS
FunctionINVOLVED AT THE TERMINAL (THIRD) STEP IN PROLINE BIOSYNTHESIS [CATALYTIC ACTIVITY: L-proline + NAD(P)+ = 1-pyrroline-5-carboxylate + NAD(P)H].
ProductPROBABLE PYRROLINE-5-CARBOXYLATE REDUCTASE PROC (P5CR) (P5C REDUCTASE)
Evidenceexperimental (in M. tuberculosis)
CommentsML2430c, len: 294 aa. Probable proC, pyrroline-5-carboxylate reductase (EC 1.5.1.2). Similar to Mycobacterium tuberculosis pyrroline-5-carboxylate reductase Rv0500 SW:PROC_MYCTU (Q11141) (295 aa) fasta scores: E(): 0, 82.4% identity in 295 aa, and to Escherichia coli pyrroline-5-carboxylate reductase SW:PROC_ECOLI (P00373) (269 aa) fasta scores: E(): 1.2e-17, 34.0% identity in 285 aa. Contains Pfam match to entry PF01089 P5CR, Delta 1-pyrroline-5-carboxylate reductase. Contains PS00521 Delta 1-pyrroline-5-carboxylate reductase signature.
Molecular mass (Da)30236.8
Isoelectric point4.48
Gene length (bp)885
Protein length295
Location (kb)2906.38


Functional categoryintermediary metabolism and respiration


Annotation Changescoordinates updated on 11-AUG-2009


Coordinates
TypeStartEndOrientation
CDS29054982906382-


Protein sequence in FASTA format
>M. leprae TN | proC
MLSSMARIAIIGGGSIGEALLSGLLRAGRQVKDLVVAERMPDRARYLADTYSVLVTSVTDAVENAMFVVVAVKPTDVESV
MGDLVQAAAVANDSAEQVLVTVAAGVTITYLESKLPAGTPVVRAMPNAAALVGAGVTVLAKGRFVTGQQFEDVLAMFDAV
GGVLTVPESQMDAVTAVSGSGPAYFFLLVEALVDAGVAVGLTRQVATELAAQTMAGSAAMLLERMDQDRHSAEVAPLGAQ
VDVPAAQLRATITSPGGTTAAALRELERGGLRMVVDAAVQAAKIRSEQLRITSE*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Enzyme Classification1.5.1.2
Gene Ontologypyrroline-5-carboxylate reductase activity
binding
cytoplasm
proline biosynthetic process
oxidation reduction
MtuberculosisRv0500
UniProtP46725


Interacting Drugs/Compounds
TDR TargetsML2430