Quick Search

Enter gene name or accession number


Gene: ML2439

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameregX3
Accession numberML2439c
TypeCDS
FunctionTRANSCRIPTIONAL REGULATORY PROTEIN PART OF THE TWO COMPONENT REGULATORY SYSTEM REGX3/SENX3.
ProductTWO COMPONENT SENSORY TRANSDUCTION PROTEIN REGX3 (TRANSCRIPTIONAL REGULATORY PROTEIN) (PROBABLY LUXR-FAMILY)
CommentsML2439c, len: 198 aa. regX3, response regulator protein (sensory transduction protein). Similar to Synechococcus sp alkaline phosphatase synthesis transcriptional regulatory protein SphR SW:SPHR_SYNP7 (P39663) (257 aa) fasta scores: E(): 6.6e-33, 47.1% identity in 206 aa, and to Mycobacterium tuberculosis sensory transduction protein RegX3 Rv0491 SW:RGX3_MYCTU (Q11156) (227 aa) fasta scores: E(): 0, 95.9% identity in 197 aa. Also similar to ML0773, ML0174 and ML2123 from M. leprae. Contains Pfam match to entry PF00486 trans_reg_C, Transcriptional regulatory protein, C terminal. Contains Pfam match to entry PF00072 response_reg, Response regulator receiver domain.
Molecular mass (Da)21818.9
Isoelectric point5.12
Gene length (bp)597
Protein length199
Location (kb)2915.09


Functional categoryregulatory proteins


Annotation Changescoordinates updated on 11-AUG-2009


Coordinates
TypeStartEndOrientation
CDS29144972915093-


Protein sequence in FASTA format
>M. leprae TN | regX3
VVTDGPAALAEFDRSGADIVLLDLMLPGMSGTDVYKQLRVRSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELI
ARIRAVLRRGGDDDSEISDGVLESGPLRMDVERHVVSVNGYAITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGVDYVG
DTKTLDVHVKRLRSKIEADPANPVHLVTVRGLGYKLES*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains Protein Family Domains


Orthologs/Cross-references
Gene Ontologytwo-component response regulator activity
two-component signal transduction system (phosphorelay)
DNA binding
intracellular
transcription
regulation of transcription, DNA-dependent
MtuberculosisRv0491
UniProtP54884


Interacting Drugs/Compounds
TDR TargetsML2439