Quick Search

Enter gene name or accession number


Gene: 5055

MMAR_5055
General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namenat
Accession numberMMAR_5055
TypeCDS
Functioncould have a role in acetylating, and hence inactivating, the antitubercular drug isoniazid [catalytic activity: acetyl-CoA + arylamine = CoA + N-acetylarylamine].
Productarylamine N-acetyltransferase Nat
Topology predictionCytosolic
Molecular mass (Da)30634.8
Isoelectric point5.17
Gene length (bp)843
Protein length281
Location (kb)6137.77


Functional categoryintermediary metabolism and respiration


Coordinates
TypeStartEndOrientation
CDS61369256137767-


Protein sequence in FASTA format
>M. marinum M | nat
MALDLTGYLDRINYRGATDPTLDVLRDLVSAHTGAIAFENLDPLMGVPVDDLSAEALADKLVDRRRGGYCYEHNGLIGYV
LAELGYRVRRLAGRVVWLAPPDAPTPAQTHTVLAVTFPGCQGPYLVDVGFGGMTPTAPLRLETGTVQQTALEPYRLDDRG
DGLVLQAMVRDEWQALYEFSTLTRPQVDLRVGSWFVSTHPTSHFVTGLMAATVADDARWNLMGRNLAIHRRGGTEKILLE
DAAAVVDTLGDRFGINVADVGERGRLEARIDKVCFGAENR*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
PFAMProtein Family Domains
Protein Data Bank2VFB 2VFC 3LTW


3D Structure Viewer


Orthologs/Cross-references
Gene Ontologymetabolic process
acetyltransferase activity
MtuberculosisRv3566c
UniProtB2HIZ6