Quick Search

Enter gene name or accession number


Gene: MMAR_0634

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namekdpD
Accession numberMMAR_0634
TypeCDS
Functionmember of the two-component regulatory system KdpD/KdpE involved in the regulation of the Kdp operon. KdpD may function as a membrane-associated protein kinase that phosphorylates KdpE in response to environmental signals.
Producttwo component system response phosphate sensor kinase, KdpD
LocalisationMembrane
Molecular mass (Da)89934.9
Isoelectric point5.44
Gene length (bp)2520
Protein length840
Location (kb)747.565


Functional categoryregulatory proteins


Coordinates
TypeStartEndOrientation
CDS747565750084+


Protein sequence in FASTA format
>M. marinum M | kdpD
VTPDYPRKRGELRIYLGAAPGVGKTFAMLGEAQRRLERGTDVVAAVVETHGRKRTAELLEGIERIPPKFIEYRGSRFAEL
DVEAVLRRQPQVVLVDELAHTNTPGSKNPKRWQDVEELLDAGITVISTVNVQHLESLNDVVAQITGIEQQEKVPDEIVRA
AEQVELVDITPEALRRRLAHGNVYAAERVDAALANYFRTGNLTALRELALLWLADQVDAALEKYRADKKITATWEARERV
VVAVTGGPESETLVRRAFRIASKASAELMVVHLARGDGLSGVAAPQMGKVRELAASLGATVHTVVGDDVPTALLDFAREM
NATQLVLGTSRRSRWARVLDEGIGATVVQQSGPIDVHMVTHQEAGRPARWSWLWPREHHLVSWLAAVVVPSLICALTVAW
LDRFLAVGGESALFVIGVLVVALLGGVAPAALSAVLSGLLLNYFLIEPRYTFTIADPDNAVTTLVLLVVAVAVAALVDNA
AKRSREAGRASREAELLALFAGSVLRGADLEALLEKVRETYSQRAVSILRIEAGTSQGAIVSCVGEDPCVDVDTADTAID
VGDDEFWMLMAGRKLLARDRRVLTAVAKQAAGLIKQRELADEAGKAQAIEQADQLRRALLSAVSHDLRTPLAAAKAAVSS
LRSDDVDFSADDMGELLATIEESVDQLTALVGNLLDSSRLAAGVVRPQLRRVYLEETVQRALLGISRGATGYGRSGLDRV
KVEVGGAVAIADAGLLERVLANLIDNGLRYAPDSPVRVYAGRVGDRVLINVADEGPGIPRGAEEQMFAPFQRLGDRDNRI
GVGLGLSVAKGFVEAMGGTISATDTPGGGLTVVVDLAAA*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Enzyme Classification2.7.13.3
Gene Ontologytwo-component sensor activity
two-component signal transduction system (phosphorelay)
ATP binding
response to stress
membrane
peptidyl-histidine phosphorylation
MtuberculosisRv1028c
UniProtB2HPR8