Quick Search

Enter gene name or accession number


Gene: MMAR_0635

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namekdpE
Accession numberMMAR_0635
TypeCDS
Functionreceiver domain of the two-component regulatory system Kdp/KdpE involved in the regulation of the Kdp operon.
Producttranscriptional regulatory protein KdpE
Topology predictionCytosolic
Molecular mass (Da)24898.6
Isoelectric point5.86
Gene length (bp)681
Protein length227
Location (kb)750.081


Functional categoryregulatory proteins


Coordinates
TypeStartEndOrientation
CDS750081750761+


Protein sequence in FASTA format
>M. marinum M | kdpE
MTRVLVIDDEPQILRALRINFSVRGYDVVTAATGAAALRAAAEQRPDVVILDLGLPDMSGIEVLAGLRGWFSAPVIVLSA
RSDSSDKVQALDAGADDYVTKPFGMDELLARLRAAVRRAATATDTDQPVIETSSFTVDLATKKVIKNGSEVHLTPTEWGM
LEMLVRNRGKLVGREELLKEVWGPAYAKETHYLRVYLAQLRRKLEDDPAHPRHLLTEAGMGYRFDG*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologytwo-component response regulator activity
two-component signal transduction system (phosphorelay)
DNA binding
transcription
regulation of transcription, DNA-dependent
MtuberculosisRv1027c
UniProtB2HPR9