Quick Search

Enter gene name or accession number


Gene: MMAR_0713

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namepknG
Accession numberMMAR_0713
TypeCDS
Functioninvolved in signal transduction (via phosphorylation). thought to regulate amino-acid uptake and stationary-phase metabolism. phosphorylates the peptide substrate myelin basic protein (MBP) at serine residues [catalytic activity: ATP + a protein = ADP + a P
Productserine/threonine-protein kinase PknG
LocalisationMembrane
Molecular mass (Da)83291.3
Isoelectric point5.25
Gene length (bp)2304
Protein length768
Location (kb)860.694


Functional categoryregulatory proteins


Coordinates
TypeStartEndOrientation
CDS858391860694-


Protein sequence in FASTA format
>M. marinum M | pknG
MAEAVKKGLQDTSGTENPRPAEDEQEAGPGTQPADVQTGAAAWSRPIGTQALFRPNFDDDDEDDITLGTLDMQPQGPLAA
ATRARLPVRRLGGGLVEIPRVPDTDPLKALMTDPVVPEAKRFCWNCGRPVGRSDSETKGASEGWCPYCGSPYSFLPQLSP
GDTIAGQYEVKGCIAHGGMGWIYLALDRNVNDRPVVLKGLVHSGDAEAQAIAMAERQFLAEVVHPSIVQIFNFVEHTDKH
GDPVGYIVMEYVGGRSLKRRKGEKLPVSEAIAYLLEILPALAYLHALGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSF
GYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLNLPTRNGRYLDGLPDDDPVLASYDSFGRLLRRAIDPDPRRRFA
SAEEMSGQLMGVLREVVAQDTGVPRPGLSTVFSPSRSTFGVDLLVAHTDVYQDGQVHSEKLTAKEIVTALQVPLVDRTDV
AASVLQATVLSQPVQTLDSLRAARHGALDSDGADLSESVELPLMEVRALLDLGDVAKATRKLDDLSERVGWRWRLVWYRA
VSELLTGAYDAAIKHFTEVLDTFPGELAPKLALAATAELAGYTDGTNFYQTVWSTNDGVISAAFGLARTLSAQGERAGAV
RTLDEVPPSSRHFTTARLTSAVTLLSGRSHGEITEEQIRDAARRVEALPPTEPRVLQIRALVLGGAMDWLQDNEASTNHI
LGFPFTDHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologyprotein serine/threonine kinase activity
ATP binding
protein amino acid phosphorylation
MtuberculosisRv0410c
UniProtB2HPZ5