Quick Search

Enter gene name or accession number


Gene: MMAR_0816

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameregX3
Accession numberMMAR_0816
TypeCDS
Functiontranscriptional regulatory protein part of the two component regulatory system RegX3/SenX3.
Producttwo component sensory transduction protein RegX3
Topology predictionCytosolic
Molecular mass (Da)24803.4
Isoelectric point4.82
Gene length (bp)684
Protein length228
Location (kb)978.965


Functional categoryregulatory proteins


Coordinates
TypeStartEndOrientation
CDS978965979648+


Protein sequence in FASTA format
>M. marinum M | regX3
MTSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRSGADIVLLDLMLPGMSGTDVCKQLRARSSVPVIMVTA
RDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRRGGDDDSEVSDGVLESGPVRMDVERHVVSVNGDAITLPLKEFD
LLEYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEADPANPVHLVTVRGLGYKLEG*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologytwo-component response regulator activity
two-component signal transduction system (phosphorelay)
DNA binding
regulation of transcription, DNA-dependent
MtuberculosisRv0491
UniProtB2HQV6