Quick Search

Enter gene name or accession number


Gene: MMAR_0826

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameproC
Accession numberMMAR_0826
TypeCDS
Functioninvolved at the terminal (third) step in proline biosynthesis [catalytic activity: L-proline + NAD(P)+ = 1-pyrroline-5-carboxylate + NAD(P)H].
Productpyrroline-5-carboxylate reductase ProC
LocalisationMembrane
Molecular mass (Da)30063.3
Isoelectric point4.9
Gene length (bp)885
Protein length295
Location (kb)988.464


Functional categorycell wall and cell processes


Coordinates
TypeStartEndOrientation
CDS988464989348+


Protein sequence in FASTA format
>M. marinum M | proC
MLSGMPRIAIIGGGSIGEALLSGLLRAGRQVKDLVVAERVPERAKYLASTYSVLVTSAKDAAESASLVVVAVKPGDVDSV
MGDLSAVVAAAESYSGEQVFVTVAAGVTTSYFESKLPAGTPVVRAMPNAAALVSAGVTALAKGRFVTPEQLEEVSALFDS
VGVVLTVPEQQLDAVTALSGSGPAYFLLMVEALVDAGVAAGLSRQVATDLTAQTMAGSAAMLLERMDQDRRGAAEPLGLR
VDTSPAQLRASVTSPGGTTAAALRELEREGFRGAVDAAVQAAKSRSEQLRITSE*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Enzyme Classification1.5.1.2
Gene Ontologypyrroline-5-carboxylate reductase activity
proline biosynthetic process
oxidation reduction
MtuberculosisRv0500
UniProtB2HQW6