Quick Search

Enter gene name or accession number


Gene: MMAR_1337

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMMAR_1337
Accession numberMMAR_1337
TypeCDS
Functionsensor part of a two component regulatory system.
Productsensor kinase from two component regulatory system
LocalisationMembrane
Molecular mass (Da)53668
Isoelectric point5.06
Gene length (bp)1500
Protein length500
Location (kb)1629.19


Functional categoryregulatory proteins


Coordinates
TypeStartEndOrientation
CDS16291881630687+


Protein sequence in FASTA format
>M. marinum M | MMAR_1337
MSTLGNLLAENTMLPGNAVDHLHAVVGEWQLLADLSFADYLMWVARDDGALVCVAQCRPNTAPTVLQTDAVGSVVEADRL
PLVAETFASGSARRDSDADQQHLGQLPGPSIEASPVRYGDQVVAVLTQHQTAVAAERASGHLESAYRDCATDLLQMLAEG
TFPDVGDVAMSRSTPRAGDGFIRLDVDGVAIYASPNALSAYHRMGLTTELEGHELIEVTRPLISDPFEAEEVAEHVRDLL
VGGRSMRMEVDAGGATVLLRTLPLVVGGVSAGAAILIRDVTEVKRRDRALISKDATIREIHHRVKNNLQTVAALLRLQAR
RTTNAEGREALIESVRRVSSIALVHDALSMSVDEQVNLDEVIDRILPIMNDVASVDRPIRINRVGDLGVLDSDRATALIM
VITELVQNAIEHAFDPAAQGAVTIRAERSARWLDVVVHDDGRGLPSGFSLEKSDSLGLQIVRTLVSAELDGSLGMREAPG
RGTDVVLRVPIGRRGRLLA*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologytwo-component sensor activity
ATP binding
signal transduction
peptidyl-histidine phosphorylation
MtuberculosisRv3220c
UniProtB2HET9