Quick Search

Enter gene name or accession number


Gene: MMAR_1516

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namedevR
Accession numberMMAR_1516
TypeCDS
Functionregulator part of the two component regulatory system DevR/DevS. controls HspX|Acr expression.
Producttwo component transcriptional regulatory protein DevR
Topology predictionCytosolic
Molecular mass (Da)23393.1
Isoelectric point5.81
Gene length (bp)651
Protein length217
Location (kb)1832.38


Functional categoryregulatory proteins


Coordinates
TypeStartEndOrientation
CDS18323801833030+


Protein sequence in FASTA format
>M. marinum M | devR
LVTVFLVDDHEVVRRGLIDLLDADPQLDVVGEAGSVSEAMARIPAANPDVAVLDVRLPDGDGIELCRDLLSRMPNLRCLI
LTSYTSDEAMLDAILAGASGYVVKDIKGMELARAIKEVGAGRSLLDNRAAAALMSRLRGVVERPDPLSGLTDQERTLLGL
LSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFAAELKRARSAGHR*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologytwo-component response regulator activity
two-component signal transduction system (phosphorelay)
transcription factor activity
intracellular
transcription
regulation of transcription, DNA-dependent
sequence-specific DNA binding
MtuberculosisRv3133c
UniProtB2HGI1