Quick Search

Enter gene name or accession number


Gene: MMAR_1794

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namepknI
Accession numberMMAR_1794
TypeCDS
Functioninvolved in signal transduction (via phosphorylation). thought to be involved in cell division/differentiation [catalytic activity: ATP + a protein = ADP + a phosphoprotein].
Producttransmembrane serine/threonine-protein kinase I PknI
LocalisationMembrane
Molecular mass (Da)62946.3
Isoelectric point5.29
Gene length (bp)1803
Protein length601
Location (kb)2191.82


Functional categoryregulatory proteins


Coordinates
TypeStartEndOrientation
CDS21918222193624+


Protein sequence in FASTA format
>M. marinum M | pknI
MALDNGAVYAGYTVVRRLRADATGESYLVSEPGFPGWQVLEILPQSWSSDDAFRRRFERDSAIAARLYHPHIVEVRAHGE
LDGRLWIAMDYIEGIDVGQLMRDRFPAVLPVGEVLEIVAPVADALDYAHQRGLVHGDVKPADIVMTNAGEGQPRILLKGF
GIAAPHGAPGDATGFVAPEQLTGAEADGRSDQYALAATAMILLTGAAPGGGSPSAAPKLSDLRPDLARLDALFARALATE
PAGRFRTCHELADALRDEVGGSFGAAGRDDMEVGASWDLSPDAEATGASQDREVLDYPAYGWPAVAPPQPPVHPGPMPMA
PQPPATLLQAVAASLARRLNEFSAAGREPRKRRLRRILIGSVVAILLVGMLAVAIPSLREITSSPPPAAAPATSSPPAPS
TSATSPQAATPEPLDGTYSIEIQRAKQLYNGRPSPQPPNVTTWWAIQSSCIPTGCLAAAAMLDGYGHGQAKQGIPPIIME
FSEGQWRSRPDTVRFACIGPNGEANTQTTVQVLTLRPQSTGDLVGALVVTVETNECGQQSAVIRIPAVASRSGDIPPGIK
VPNPVTIPKAPQAPATSESPSETPTVTPTTPTTAPSGPGR*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Gene Ontologyprotein kinase activity
ATP binding
protein amino acid phosphorylation
integral to membrane
MtuberculosisRv2914c
UniProtB2HJK7