Quick Search

Enter gene name or accession number


Gene: MMAR_2395

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namehisD
Accession numberMMAR_2395
TypeCDS
Functioninvolved in histidine biosynthesis pathway (tenth step). this protein is considered as a bifunctional enzyme, possessing two active sites, one an alcohol dehydrogenase and the other an aldehyde dehydrogenase [catalytic activity : l-histidinol + 2 NAD(+) + H(2)O = L-histidine + 2 NADH].
Producthistidinol dehydrogenase HisD
Topology predictionCytosolic
Molecular mass (Da)46285.5
Isoelectric point5.28
Gene length (bp)1344
Protein length448
Location (kb)2891.07


Functional categoryintermediary metabolism and respiration


Coordinates
TypeStartEndOrientation
CDS28910662892409+


Protein sequence in FASTA format
>M. marinum M | hisD
MVGVSTPRSLLARVDLRGAELTAAGLRAALPRGGADVEAVLPKVRPIVAAVAERGAQAALEFCESFDGVRPAAVRVPQAA
LAAALDELSPDVRDALQVMIERTRAVHADQRRTDVVTTLGPGATVTERWIPVERVGLYVPGGNAVYPSSVVMNVVPAQAA
GVDSLVVASPPQASHGGLPHPTILAAARLLGVDEVWAVGGAQAVALLAYGGTDVDGHELAPVDMITGPGNIYVTAAKRLC
RSQVGIDAEAGPTEIAILADHTADPAHVAADLISQAEHDEMAASVLVTPSEHLADATDAELAAQLATTVHHERVTTALGG
RQSAIILVDDLDAGVKVVNAYAAEHLEIQTADAPQVASRIRSAGAIFVGPWAPVSLGDYCAGSNHVLPTAGFARHSSGLS
VQTFLRGIHVVDYTEAALKDVSGHVLTLAKAEDLPAHGEAVRRRFER*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Enzyme Classification1.1.1.23
Gene Ontologyhistidine biosynthetic process
histidinol dehydrogenase activity
zinc ion binding
NAD or NADH binding
oxidation reduction
MtuberculosisRv1599
UniProtB2HQA2