Quick Search

Enter gene name or accession number


Gene: MMAR_3236

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nametrpD
Accession numberMMAR_3236
TypeCDS
Functiontryptophan biosynthesis
Productanthranilate phosphoribosyltransferase TrpD
Topology predictionSecreted
Molecular mass (Da)37808.9
Isoelectric point5.17
Gene length (bp)1104
Protein length368
Location (kb)3944.65


Functional categoryintermediary metabolism and respiration


Coordinates
TypeStartEndOrientation
CDS39435443944647-


Protein sequence in FASTA format
>M. marinum M | trpD
VVLSSEASSAADHSAAAPIPTSSWPQLLGRLTEGKHLEPGQAGWAMEQIMSGNARPAQVAAFAVAMKMKVPTAGEVGELA
DVMLAYARPMPADLIRDDTVDIVGTGGDGVNTVNLSTMASIVVAAAGVPVVKHGNRAASSLAGGADTLEALGVRIDLGPD
QVARSLNEIGIGFCFAPQFHPSYRQASVVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEIMAGVFATRGSSVLV
VHGDDGLDELTTTTTSTIWRVQAGTVDKLTFDPGDFGFARAELSQLLGGDPQANAAEARAVLGGAAGPVRDAVVLNAAGA
IVAHAGLSSRAEWLPAWQDGLQRAAVAIDSGAAEQLLARWVRFSQHV*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Enzyme Classification2.4.2.18
Gene Ontologytryptophan biosynthetic process
anthranilate phosphoribosyltransferase activity
MtuberculosisRv2192c
UniProtB2HGW0