Quick Search

Enter gene name or accession number


Gene: MMAR_3309

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameptpA
Accession numberMMAR_3309
TypeCDS
Functioninvolved in signal transduction (via dephosphorylation). can dephosphorylated in vitro the phosphotyrosine residue of myelin basic protein (MBP) at ph 7.0 [catalytic activity: protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.
Productphosphotyrosine protein phosphatase PtpA
Topology predictionCytosolic
Molecular mass (Da)18227.3
Isoelectric point5.49
Gene length (bp)495
Protein length165
Location (kb)4084.06


Functional categoryregulatory proteins


Coordinates
TypeStartEndOrientation
CDS40840644084558+


Protein sequence in FASTA format
>M. marinum M | ptpA
VSDSTLHVTFVCTGNICRSPMAEKMFAHQLRERGLGEAVRVTSAGTGNWHVGNRADERARQVLHSHGYPTDHCAAQVGTD
HLEADLVIALGRNHARQLRQLGVEESRLRMLRSFDPRSGAYVLDVEDPYYGGHDDFEEVLVVIEAALPGLHDWVDEQLAQ
DGKV*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologyprotein tyrosine phosphatase activity
protein amino acid dephosphorylation
MtuberculosisRv2234
UniProtB2HHN7