Quick Search

Enter gene name or accession number


Gene: MMAR_3417

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namecysH_1
Accession numberMMAR_3417
TypeCDS
Functioninvolved in the sulfate activation pathway (at the third step) in the reductive branch of the cysteine biosynthetic pathway. reduces activated sulfate into sulfite [catalytic activity: 5-phosphoadenosine 3-phosphosulfate + reduced thioredoxin = phosphoadenosine phosphate + oxidized thioredoxin + sulfite].
Product3'-phosphoadenosine 5'-phosphosulfate reductase CysH_1
Topology predictionCytosolic
Molecular mass (Da)26764.2
Isoelectric point5.31
Gene length (bp)735
Protein length245
Location (kb)4218.14


Functional categoryintermediary metabolism and respiration


Coordinates
TypeStartEndOrientation
CDS42181364218870+


Protein sequence in FASTA format
>M. marinum M | cysH_1
MSDQPNETQLRELAARGAAEMEGASATDLLRWADEHFGGINGPRGWATCNYVVASNMQDAVLIDLASKVRPGVPVIFLDT
GYHFAETIGTRDAIEAVYDIRVLNISPEHTVAEQDKLLGKDLFARDPNECCRLRKVVPLTNALRGYAAWITGLRRVESPT
RANAPVISFDEAFKLVKINPLVSWTDQDVQDYIQSNNVLVNPLVDEGYPSIGCAPCTAKPAVGEDPRSGRWRGRTKTECG
LHAS*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologyphosphoadenylyl-sulfate reductase (thioredoxin) activity
transferase activity
cysteine biosynthetic process
sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin)
oxidation reduction
MtuberculosisRv2392
UniProtB2HIT5