Quick Search

Enter gene name or accession number


Gene: MMAR_3418

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMMAR_3418
Accession numberMMAR_3418
TypeCDS
FunctionUNKNOWN
Productconserved hypothetical protein
Topology predictionCytosolic
Molecular mass (Da)25297.1
Isoelectric point9.98
Gene length (bp)720
Protein length240
Location (kb)4218.87


Functional categoryconserved hypotheticals


Coordinates
TypeStartEndOrientation
CDS42188674219586+


Protein sequence in FASTA format
>M. marinum M | MMAR_3418
MSTLVLTAHGSRDPRSADNARAVAAALRRMRPNLDVRLAFLELCAPNFVEVLAELPDSQRAVVTPLLLASAYHARTDIPE
QIARSGALGVREAAVLGEDDRLVSVLRDRLAERGVSPRDRNIGVLVVAVGSSHAPVNARTARVAAKLGAGTRWAGTTMAF
ATGPKPSVADAAAQLRASGARRLVIAPWFLAPGLITDRVWKYACDNDIAMARPMGAHPLVAQTVLDRYDQALATGDAAA*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologycobalamin biosynthetic process
lyase activity
metal ion binding
MtuberculosisRv2393
UniProtB2HIT6