Quick Search

Enter gene name or accession number


Gene: MMAR_3712

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMMAR_3712
Accession numberMMAR_3712
TypeCDS
Functionunknown but contains a chelatase superfamily domain. given the presence of other heme-associated CDS in this region and the presence of a chelatase superfamily domain, this CDS may encode a ferrochelatase, catalyzing the last step in HemE biosynthesis.
Productconserved hypothetical protein
LocalisationMembrane
Molecular mass (Da)24821.5
Isoelectric point11.14
Gene length (bp)714
Protein length238
Location (kb)4572.05


Functional categorycell wall and cell processes


Coordinates
TypeStartEndOrientation
CDS45720464572759+


Protein sequence in FASTA format
>M. marinum M | MMAR_3712
VTALVLTAHGSRDPRSSANARAVAARVARMRPDLDVRLAFCELNSPGLVEVLNGCSGDAVVTPLLLANGYHAGIDIPAQI
ASCRESLRVRQANVLGTDDRLVSVLRQRVTALGVSRFDDGLGVLVVAIGSSNAAVNSHTAQVGPKLAEGTRWAAVATAFA
THPPAALAEAVSRLRRRGAHRVVVAPWFLAHGRLPDRVQRFAADTGLAMAAPLGAHRLVAETVLDRFAQATAGRVAA*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologycobalamin biosynthetic process
lyase activity
metal ion binding
MtuberculosisRv2393
UniProtB2HMA8