Quick Search

Enter gene name or accession number


Gene: MMAR_3713

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameggtB
Accession numberMMAR_3713
TypeCDS
Functionplays a key role in the gamma-glutamyl cycle, a pathway for the synthesis and degradation of glutathione [catalytic activity: 5-L-glutamyl)-peptide + an amino acid = peptide + 5-L-glutamyl-amino acid].
Productgamma-glutamyltranspeptidase precursor GgtB
Topology predictionCytosolic
Molecular mass (Da)66490.3
Isoelectric point5.49
Gene length (bp)1941
Protein length647
Location (kb)4572.77


Functional categoryintermediary metabolism and respiration


Coordinates
TypeStartEndOrientation
CDS45727744574714+


Protein sequence in FASTA format
>M. marinum M | ggtB
MTFVKRCGAVLAVAALALAGCGTTHVGAPNSAGPCEIVPNGTPAPKTSVAAAAPSSRNVATNPEIATGYRTDMTPVHTAH
YSVSAANPLATQAACRVLRDGGTAADAVVAAQAVLGLVEPQSSGIGGGGVLLYYDARTRSVQAYDGREVAPAAATENYMR
WISDADHSAPRPDPRASGRSIGVPGILRMLEMVHNEHGTTPWRDLFSPAVALADNGFDISPRMAAAISDSAPQLGADPQA
RGYFLTPDGTPKAVGTRLTNPAYAKALSEIASAGASVFYTGDIAHDIVAAAGDTSGGRTPSLITLEDLSAYPAKKREPLC
TTYRGRQICGMPTPSSGGVAVAATLGILEHFPMSEYRPDNLDPNGGRPSVMGVHLVAEAERLAYADRDKYVADADFVPPP
GGSLSTLVDPAYLAGRAALISPQHSMGTAKPGDFGLPTTIAAPVPEHGTSHVSVVDSYGNAAALTTTVESAFGSFHMVDG
FLLNNQLSDFNAQPYDSDGAPVANRIQPGKRPRSSMAPTFVFDGAPAEHSSLYAVVGSPGGSTIVQFVVKTLVAMLDWGL
DPQQAVSAVDFGAANTPRTNVGGEHPDINTADNGAHDPLVEGLRALGHQVNLADQSSGLSAITRSKSGWTGGADPRREGV
VMGDTS*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologygamma-glutamyltransferase activity
MtuberculosisRv2394
UniProtB2HMA9