Quick Search

Enter gene name or accession number


Gene: MMAR_3714

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMMAR_3714
Accession numberMMAR_3714
TypeCDS
Functionunknown but domain identity suggests a role in transporting oligopeptides as signals across the membrane.
Productconserved hypothetical membrane protein
LocalisationMembrane
Molecular mass (Da)68085.2
Isoelectric point8.77
Gene length (bp)2004
Protein length668
Location (kb)4574.81


Functional categorycell wall and cell processes


Coordinates
TypeStartEndOrientation
CDS45748064576809+


Protein sequence in FASTA format
>M. marinum M | MMAR_3714
MSGALGSTREITTRGIILGGLITLVFTAANVYLGLKVGLTFATSIPAAVISMGVLRLFANHSIVENNIVQTIASAAGTLS
AIIFVLPALIMIGWWSGFPYWTTVAVCGFGGLLGVMYSIPLRRALVTGSDLPYPEGVAGAEVLKIGASARGAEENRRGLS
VIALGAVTAAGYSLLAALKVISNSLAVTFRLGSGATMAGASLSLALVGVGHLVGLGVGIAMIVGVLISYGVLLPMRTAGQ
LPQDGALADFVSRTFSSDVRFIGAGAIAVAAVWTFLKIAGPIMAGIAEAAVSARTRRRGEAVDLHERDIPIQVVGLVVLV
SLIPIGLLLGDFTDHTPIAGRAGSIIAVSLLLIVTIGLVVASVCGYMAGLIGSSNSPISGVGILVVLLAALLIKWTYGPA
SDAQTPALVAYAVFTAAVIFGVATISNDNLQDLKTGQLVGATPWKQQVALVIGVTIGAAVMAPVLQLMQSAFGFQGAPGA
TGNALAAPQAALISALAKGVFGGSLNWSLVGLGALIGIVVVVVDEVLTRTTATLRLPPLAVGMGMYLPISLTLVIPVGAV
LGRIYDSWAQRSGDEDESKRRMGVMLATGLIVGESLFGVAFAGIVVATGTEDPLAILGDGFTHWAELLGLFVFAAMIALL
YRYVRAAASYRPTTPGQEPEPLSGRAG*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
MtuberculosisRv2395
UniProtB2HMB0