Quick Search

Enter gene name or accession number


Gene: MMAR_3715

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namecysA1
Accession numberMMAR_3715
TypeCDS
Functioninvolved in the active transport across the membrane of multiple sulfur-containing compounds, including sulfate and thiosulfate (import). responsible for energy coupling to the transport system.
Productsulfate-transport ATP-binding protein ABC transporter CysA1
LocalisationMembrane
Molecular mass (Da)38926.1
Isoelectric point6.32
Gene length (bp)1110
Protein length370
Location (kb)4577.95


Functional categorycell wall and cell processes


Coordinates
TypeStartEndOrientation
CDS45768384577947-


Protein sequence in FASTA format
>M. marinum M | cysA1
MKKETSLTGPGTGGHAIVVRDAFKQYGDFVALDHVDFVVPAGSLTALLGPSGSGKSTLLRTIAGLDQPDSGNITINGRDV
TRVPPQRRGIGFVFQHYAAFKHLTVRDNVAYGLKIRKRPKAEIRDKVDNLLEVVGLSGFHGRYPNQLSGGQRQRMALARA
LAVDPEVLLLDEPFGALDAKVREDLRAWLRRLHDEVHVTTVLVTHDQAEALDVADRIAVLNSGRIEQVGSPTEVYDAPAN
AFVMSFLGAVSALNGALVRPHDIRVGRTPEMAVAAADGTGESTGVTRAVVDRIVVLGFEVRVELTSAATGGAFTAQITRG
DAEALALQEGDTVYVRATRVPPIAGAAPAVPDDGAGSTPSAAQIGVGGQ*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene OntologyATP binding
sulfate transport
sulfate transmembrane-transporting ATPase activity
ATP-binding cassette (ABC) transporter complex
MtuberculosisRv2397c
UniProtB2HMB1