Quick Search

Enter gene name or accession number


Gene: MMAR_3717

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namecysT
Accession numberMMAR_3717
TypeCDS
Functioninvolved in the active transport across the membrane of multiple sulfur-containing compounds, including sulfate and thiosulfate (import). responsible for the translocation of the substrate across the membrane.
Productsulfate-transport integral membrane protein ABC transporter CysT
LocalisationMembrane
Molecular mass (Da)31412.6
Isoelectric point5.85
Gene length (bp)903
Protein length301
Location (kb)4579.66


Functional categorycell wall and cell processes


Coordinates
TypeStartEndOrientation
CDS45787594579661-


Protein sequence in FASTA format
>M. marinum M | cysT
MTVTAHSGQSDPPAVAPDPGQRADGGPQWISGLGRSGRRGATALQVGVSMVWLSVIVLLPLAAIAWQAADGGWHAFWLSV
SSHAALESLRVTLTVSAGVTLLNTVFGLLIAWVLIRDEFVGKRLVDAVIDLPFALPTIVASLVMLALYGHNSPLGLHLQH
TVWGVGVALAFVTLPFVVRAVQPVLLELDRETEEAAASLGATGWKVFTSVIFPSLMPALLSGAGLAFSRAIGEFGSVVLI
GGAVPGETEVSSQWIRTLIENDDRTGAAAISIVLLSISFAVLLVLRVLGARAAKREELAP*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologysulfate transport
Gram-negative-bacterium-type cell wall
sulfate transmembrane transporter activity
uptake transmembrane transporter activity
integral to membrane
MtuberculosisRv2399c
UniProtB2HMB3