Quick Search

Enter gene name or accession number


Gene: MMAR_4156

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namepknH
Accession numberMMAR_4156
TypeCDS
Functioninvolved in signal transduction (via phosphorylation). in M. tuberculosis thought to be involved in arabinan metabolism, phosphorylating perhaps EmbR [catalytic activity: ATP + a protein = ADP + a phosphoprotein].
Producttransmembrane serine/threonine-protein kinase H PknH
LocalisationMembrane
Molecular mass (Da)63578.7
Isoelectric point5.36
Gene length (bp)1791
Protein length597
Location (kb)5117.27


Functional categoryregulatory proteins


Coordinates
TypeStartEndOrientation
CDS51172685119058+


Protein sequence in FASTA format
>M. marinum M | pknH
MGEAPDSRVGSMFGPYHLKRLLGRGGMGEVYEAEHTVKEWTVAVKLMTTEFSKDPVFRERMKREARIAGRLQEPHVVPIH
DYGEIDGQMFLEMRLIEGTDLDSILKRFGPLTPPRAVAIITQIASALDAAHADGVMHRDVKPPNILITRDDFAYLVDFGI
ASATGDEKLTQLGTAVGTWKYMAPERFANEEVTYRADIYALACVLFECLTGSPPYRSDSAGTLVTAHLMDPVPQVSTVRS
GIPKAFDAVIARGMAKKPEERYASAGDLARAAHDALSNPDQDHAADILRRSRESTLPGTAAITPQPPTMPAVTPPPAMPY
ADPASSGPLPQSAPTGQPGWAPASGPIPAAHQPAQVPQYYQSGSWASTPPGTPPQQPVGPTPWNQPPPKRNPWPIVAGVA
ALVFVLIVGGIGVWLVTNSDSTPKAGPGTTGSTTTTSPKPETTSPETTTTPAGDPQARLLSYLPSGYASGVCTATTPKPN
SVWTGAVAMYNCGQNTNDGGPSRAVYGLFPSLEALKQAFNDDIAAVDLANCPGEGPSPDGWHYDRTPDVTAGMIACGTYK
NHPNVIWSNDDKLMLSDAFGDPATLDELHTWWAKYG*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologyprotein serine/threonine kinase activity
ATP binding
protein amino acid phosphorylation
integral to membrane
MtuberculosisRv1266c
UniProtB2HRD2