Quick Search

Enter gene name or accession number


Gene: MMAR_4171

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMMAR_4171
Accession numberMMAR_4171
TypeCDS
Functioninvolved in signal transduction (via phosphorylation). [catalytic activity: ATP + a protein = ADP + a phosphoprotein].
Producttransmembrane serine/threonine-protein kinase
Topology predictionCytosolic
Molecular mass (Da)70267.7
Isoelectric point6.33
Gene length (bp)2004
Protein length668
Location (kb)5135.68


Functional categoryregulatory proteins


Coordinates
TypeStartEndOrientation
CDS51356765137679+


Protein sequence in FASTA format
>M. marinum M | MMAR_4171
MSDAQGSRVGSTFGPYRLTRLLGRGGMGEVYEAEHTVKEWTVAVKLMSETFSKDPVFRERMKREARITGRLQEPHVVPIH
DYGEIDGQMYLEMRLIEGTDLDNLLKRFGPLTPPRAVAIITQVASALDAAHAAGVMHRDVKPQNILVTREDFAYLVDFGI
ASATTDEKLTQLGTAVGTWKYMAPERFSNDEVTYRADIYALACVLHECLTGSPPYRADSASMLVTAHMMDPIPQPSTVRA
GIPKAFDTVIARGMAKQPGDRYASAGDLALAAHEALSNPDQDHAADILRRSQEATLPGPPDPAAPPTMPATAAAPPARPG
PAATPPRPAPTPQQPPYYPAAAAPAAGSPPSGPSAVAGPPRGVAPSGPAGPSGPIPRPPAAGQPGWQQASGPIPASQPTP
SPPYYQGAGWGGAPPPGQPAGPSTWNQGPQGPGPRGRNPWPIVAAVAIVLVLIVGGIGVWMITQPPKPSPPPKPIAEDRL
SSLLLSPAEVNSVMGASNIQPGKPITSMDASPVTLSLPECQGALYTSQDPVYSGTGYTAISGLVASEPGDNNDHWVNQAV
VSFPSAAKASSFVETMAGKWKNCAGKTVTVTNKSKTYRWTFAQVVGSPPRITMLETQEGAEGWECQRAMSVANNVIVDIN
SCGYHITDQGGALADKIVDKIHKETKY*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologyprotein serine/threonine kinase activity
ATP binding
protein amino acid phosphorylation
integral to membrane
MtuberculosisRv1266c
UniProtB2HRE7