Quick Search

Enter gene name or accession number


Gene: MMAR_4388

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namemetB
Accession numberMMAR_4388
TypeCDS
Functioninvolved in methionine biosynthesis: converts O-succinyl-L-homoserine to cystathionine [catalytic activity : O-succinyl-L-homoserine + L-cysteine = cystathionine + succinate (can also use hydrogen sulfide and methanethiol as substrates)].
Productcystathionine gamma-synthase MetB (cgs)
Topology predictionCytosolic
Molecular mass (Da)40693
Isoelectric point5.42
Gene length (bp)1167
Protein length389
Location (kb)5396.81


Functional categoryintermediary metabolism and respiration


Coordinates
TypeStartEndOrientation
CDS53956425396808-


Protein sequence in FASTA format
>M. marinum M | metB
MKDDHKAQHRFAGLATRAIHSGYRPDPATGAVNAPIYASSTFAQDGVGGLRGGYEYARTGNPTRTALEAALAAVEDAAFG
RAFSSGMAAADCALRAMLRPGDHVVIPDDAYGGTFRLIDKVFTGWNVEYTPVALADLDAVRAAIRPTTRLIWVETPTNPL
LSIADIAGIAQLGADSSAKVLVDNTFASPALQQPLSLGADVVLHSTTKYIGGHSDVVGGALVTNDEELDQSFAFLQNGAG
AVPGPFDAYLTMRGLKTLVLRMQRHSENAAAVAEFLAEHPAISTVLYPGLPSHPGHAVAARQMRGFGGMVSVRMRAGRTA
AEQLCAKTNIFILAESLGGVESLIEHPSAMTHASTAGSQLEVPDDLVRLSVGIEDVADLLDDLKQALG*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologycatalytic activity
cellular amino acid metabolic process
pyridoxal phosphate binding
MtuberculosisRv1079
UniProtB2HT74