Quick Search

Enter gene name or accession number


Gene: MMAR_4456

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nametrcS
Accession numberMMAR_4456
TypeCDS
Functionsensor part of the two component regulatory system TrcS/TrcR.
Producttwo component sensor histidine kinase TrcS
LocalisationMembrane
Molecular mass (Da)55525.7
Isoelectric point5.47
Gene length (bp)1545
Protein length515
Location (kb)5475.08


Functional categoryregulatory proteins


Coordinates
TypeStartEndOrientation
CDS54750805476624+


Protein sequence in FASTA format
>M. marinum M | trcS
MTGHRNTPRWLPRSLRWQLLLGVLAVVTIVLVAVGGVSVLSLRGYVTAMNDAEVVESMHAFSHAYARYRNGEHTSIHTGT
PPVSQALLEFTGQTPGNLIAVVRDGVVIGSAVFSEDAPRPAPPDVIHAIETQHWTDEPSRVETLGSLGSYQVDSRAAGSD
RLIVGVSLSIADRIITRKQITTSVLVATALVITAALTVWVVGITLRPLRRVAATAATVAAMPLAGDDHQISVRVRPEDTD
PDNEVGIVGHTLNRLLDNVDSALQHRVDSDLRMRQFITDASHELRTPLAAIQGYAELTRQDSSDLPPTTEYALARIESEA
RRMASLVDELLLLSRLGEGEDLETEHLDLTDLVMNAVNDAAVAAPTHRWIKDLPDEPVWINGDHARLHQLVSNLLTNAWV
HTPPGVTVKTGITSYPDDPSGPYTELTVSNDGPDIDPEVLPHLFERFVRSSKSRSSAPGHGLGLAIVNSIVKAHDGSVTA
ESAAGQTVFRIRLPLIDAPLNASAPGRPRQPSDY*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Enzyme Classification2.7.13.3
Gene Ontologytwo-component sensor activity
two-component signal transduction system (phosphorelay)
ATP binding
integral to membrane
peptidyl-histidine phosphorylation
MtuberculosisRv1032c
UniProtB2HDH9