Quick Search

Enter gene name or accession number


Gene: MMAR_4970

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMMAR_4970
Accession numberMMAR_4970
TypeCDS
FunctionUNKNOWN
Productacyl-coenzyme a synthetase
Topology predictionCytosolic
Molecular mass (Da)58061.3
Isoelectric point5.44
Gene length (bp)1650
Protein length550
Location (kb)6033.88


Functional categorylipid metabolism


Coordinates
TypeStartEndOrientation
CDS60322346033883-


Protein sequence in FASTA format
>M. marinum M | MMAR_4970
MSRFTDAIATTASNSPRGLHFGAAGGLRFASWRDIHQTAVRVAGRLSAEGVTRGSRVTVLAAGPEDVAPVVQGIWRLGAA
MTMLQQPTSQADLAGWHAGTLRALALLDTRWVVIGEPFLAAAETLRAAGYRIIEIGESWPELAATEEPTGEDDVALYQLT
SGSTGDPKAVAITHGNLFADVAAMTAEVHLDPEVDITASWLPLSHDMGLIAYLISPMFAGNGAVYITPTEFVVSPLKWMQ
ILTERRATITAAPNFAYSIISRRLSAVEDGTYDLSALRCVVTGAEPIDPATMAEFARQAGRFGLRHTALGAAYGLAEATV
AVSFSPVDNPLTTESVCVEELENRGLALPACSCGGPTKQFVTLGPPMSGVEVRIVAADGSNLPPRRMGEIAIAGDAVARH
YLTMDGEVAAVDPDGWLFTGDLGYLTEGGEIVVCGRRKNVIIVAGRNIFPADIERLAASVHGIRRGGVVAFGVTLADRRE
EIRIVAETVADPSIEDGRELRRQIAQNVRGATGLSPTVLLVGKGKVPKTASGKIRHVMARELFGEVSPA*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologycatalytic activity
metabolic process
MtuberculosisRv0035
UniProtB2HHX4