Quick Search

Enter gene name or accession number


Gene: MMAR_5051

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namefadE31
Accession numberMMAR_5051
TypeCDS
Functionunknown, but involved in lipid degradation.
Productacyl-CoA dehydrogenase FadE31
Topology predictionCytosolic
Molecular mass (Da)41378.6
Isoelectric point5.07
Gene length (bp)1134
Protein length378
Location (kb)6132.65


Functional categorylipid metabolism


Coordinates
TypeStartEndOrientation
CDS61326556133788+


Protein sequence in FASTA format
>M. marinum M | fadE31
MDLDLDEETLAFQGEVREFLAANAEVMPTKSYDNAQGFAQHRVWDRVLFDAGLSVITWPKQYGGRDAPLLHWVIFEEEYF
RAGAPGRASANGTSMLAPTLFAHGTAEQLDRILLKMASGEQIWAQAWSEPESGSDLASLRSTATKTDGGWLLNGQKIWSS
RAPFADMGFGLFRSDPSAQRHRGLTYFMFDLKAKGITVRPIVQLGGDTGFGEIFLDDVFVPDQDVIGAPNDGWRAAMSTS
SNERGMSLRSPARFMAAAQKLVQLWKDAGSPPEFANRVADAWIKAQAYRLQTFGTVTRLAAGGELGAESSVTKVFWSDLD
VDIHQTALDIRGADAELVSPWTEGLLFALGGPIYAGTNEIQRNIISERLLGLPREKK*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologyacyl-CoA dehydrogenase activity
electron carrier activity
FAD binding
oxidation reduction
MtuberculosisRv3562
UniProtB2HIZ2