Quick Search

Enter gene name or accession number


Gene: MMAR_5052

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namefadE32
Accession numberMMAR_5052
TypeCDS
Functionunknown, but involved in lipid degradation.
Productacyl-CoA dehydrogenase FadE32
Topology predictionCytosolic
Molecular mass (Da)32535.9
Isoelectric point5.34
Gene length (bp)936
Protein length312
Location (kb)6133.79


Functional categorylipid metabolism


Coordinates
TypeStartEndOrientation
CDS61337926134727+


Protein sequence in FASTA format
>M. marinum M | fadE32
VEFALDEQQRDFAASIDAALAAADLPAAVRAWSAGDVAPGHKVWEQLANLGVTALTVSEKFDGLGAHPIDLVVALERLGR
WCVPGPVAESIAVAPVLLADDDRSAGLACGELIATVALPPHAPRAVDADTAGLVLVAGESGVSEAAVANCHESIDPSRRS
YDVTATGATWQADVKRAYEFGALATAAQLIGAAEALLDATVDYAKQRTQFGRVIGSYQAIKHKLADVHIAIELARPLVHG
AALSLQPRDVSAAKVAAGDAALLAARSALQTHGAIGFTQEHDLSLWLLRVQALRSAWGTPEVHRRRVLEAL*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologyacyl-CoA dehydrogenase activity
metabolic process
electron carrier activity
FAD binding
MtuberculosisRv3563
UniProtB2HIZ3