Quick Search

Enter gene name or accession number


Gene: MMAR_5053

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namefadE33
Accession numberMMAR_5053
TypeCDS
Functionunknown, but involved in lipid degradation.
Productacyl-CoA dehydrogenase FadE33
Topology predictionCytosolic
Molecular mass (Da)33643.4
Isoelectric point4.9
Gene length (bp)963
Protein length321
Location (kb)6134.78


Functional categorylipid metabolism


Coordinates
TypeStartEndOrientation
CDS61347776135739+


Protein sequence in FASTA format
>M. marinum M | fadE33
MTEEREMLRETVAALVNKHASPAAVRSAMESERGYDETLWRLLCEQVGAAALVIPEELGGAGGELADAAIVLQELGRALV
PSPLLGTTLAELALLAAAEPDAKTLAGLAEGSSIGALVLDPDYVLNGDTADVVVASTEGQLSRWTRFSAHRVATMDPTRR
LAQLRAEETAFLGEDPGLADAAAILLAAEQIGAAERCLELTVEYAKSRVQFGRPIGSFQALKHRMADLYVEVAAARAVVT
EACTAPTPTSAATARLAACEALCAVAAEGIQLHGGIAITWEHDMHLYFKRAHGSTHLLASPPELLRRLESEALGAGPSIP
*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologyacyl-CoA dehydrogenase activity
metabolic process
electron carrier activity
FAD binding
MtuberculosisRv3564
UniProtB2HIZ4