Quick Search

Enter gene name or accession number


Gene: MMAR_5054

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameaspB
Accession numberMMAR_5054
TypeCDS
Functionthought to be involved in glutamate biosynthesis [catalytic activity: l-aspartate + 2-oxoglutarate = oxaloacetate + L-glutamate].
Productaspartate aminotransferase AspB
Topology predictionCytosolic
Molecular mass (Da)41747.4
Isoelectric point5
Gene length (bp)1176
Protein length392
Location (kb)6135.74


Functional categoryintermediary metabolism and respiration


Coordinates
TypeStartEndOrientation
CDS61357366136911+


Protein sequence in FASTA format
>M. marinum M | aspB
MNAVNTHIARRAGIPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSVGAPEPIRAAAAAALHLNELGYTVALGIPELRAAI
AADYHRQHGISVEPEAVVITTGSSGGFLLTFLACFDVGDRVALASPGYPCYRNILSALGCEVVEIPCGPETRFQPTADML
AQIDPPVQGVIVASPANPTGTVIPPEELAAIASWCDASGARLISDEVYHGLVYEGAPPTSCAWQTSRNAVVVNSFSKYYA
MTGWRLGWLLVPTELRRAVDCLTGNFTICPPVLSQVAAVSAFTPEATKEADGNLRHYASNRSTLLDGLRRIGIDRLAPTD
GAFYVYADVSDFTDDSLKFCSKLLADTGVAIAPGIDFDTAGGNSFVRLSFAGPSEDIREALRRIESWLPER*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologytransaminase activity
biosynthetic process
1-aminocyclopropane-1-carboxylate synthase activity
pyridoxal phosphate binding
MtuberculosisRv3565
UniProtB2HIZ5