Quick Search

Enter gene name or accession number


Gene: MMAR_5056

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMMAR_5056
Accession numberMMAR_5056
TypeCDS
Functionunknown.
Productconserved hypothetical protein
Topology predictionCytosolic
Molecular mass (Da)21992.8
Isoelectric point4.98
Gene length (bp)612
Protein length204
Location (kb)6137.92


Functional categoryconserved hypotheticals


Coordinates
TypeStartEndOrientation
CDS61379206138531+


Protein sequence in FASTA format
>M. marinum M | MMAR_5056
VADVELYLDPICPFAWVTSRWLLEAAQSTHTPVTLRQMSLAVLNEGKDLDAKQQQMMQRSRQLGRLFAAVTTKYGADAFA
RLYDSIGTRIHLRREEITQGGIREALAETGLDESLSETLDDSGLDDEARHAHQASQDALGGTAGSPIIAVDGQGFFGPVL
TRMPSGADGVRLLEAVLTAAKTPEFAVLQRPYQGPPVLDGTAR*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
UniProtB2HIZ7