Quick Search

Enter gene name or accession number


Gene: MMAR_5057

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namedsbF
Accession numberMMAR_5057
TypeCDS
Functionunknown, possibly involved in thiol:disulfide interchange. contains PS00013 prokaryotic membrane lipoprotein lipid attachment site, N-term signal pepitde sequence and PS00194 thioredoxin family active site.
Productconserved lipoprotein DsbF
Topology predictionSecreted
Molecular mass (Da)18605
Isoelectric point5.81
Gene length (bp)546
Protein length182
Location (kb)6138.83


Functional categorycell wall and cell processes


Coordinates
TypeStartEndOrientation
CDS61388316139376+


Protein sequence in FASTA format
>M. marinum M | dsbF
MPRRLIASLAGIAAALTIAACGSSGTASPAGAPASSSNAVANRAAHVPAQLQFTTKTIDGKPFSGESLAGKATVLWFWTP
WCPKCQQEAPIVAKAAAANPEATFVGVAAREEASAMQAFVDKYQLGDVTQLADSDGQVWSNFGVTQQPAWAFISANGEVE
VVKGGLSEAQLTERVNGLTGK*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologyoxidoreductase activity
cell redox homeostasis
MtuberculosisRv1677
UniProtB2HIZ8