Quick Search

Enter gene name or accession number


Gene: MMAR_5058

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMMAR_5058
Accession numberMMAR_5058
TypeCDS
FunctionUNKNOWN
Productconserved hypothetical secreted protein
LocalisationMembrane
Molecular mass (Da)30196.6
Isoelectric point9.73
Gene length (bp)888
Protein length296
Location (kb)6139.37


Functional categorycell wall and cell processes


Coordinates
TypeStartEndOrientation
CDS61393736140260+


Protein sequence in FASTA format
>M. marinum M | MMAR_5058
MINTAALSFALGAGLVAALNPCGFAFLPGYLGLVIAGSQGTSRPRAVLRAGAATAGMSLGFLTVFGVFGLLISPVIASAQ
RYLPFATVVIGVLLVGLAIWLLAGKELSIILPKSMGGTPTTRLGSMYGYGVGYAVASLSCTVAPFLAVISTTFKQGSVLS
GVLAFVAYAVGMTLTVGVAALTVALAGSSATAAFRRILPFVGRIAGVIVLITGLYVAYYGYYEIRLYFTSAETDDPVIQA
ASTLQDSLIRLVDGLSPWLLVGVAAALVAVAVGWHTLARRRASNPAAQSLPDPTS*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologymembrane
cytochrome complex assembly
UniProtB2HIZ9