Quick Search

Enter gene name or accession number


Gene: MMAR_5059

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMMAR_5059
Accession numberMMAR_5059
TypeCDS
Functionunknown, but domain identity suggests this protein may have metalloendopeptidase activity.
Productconserved hypothetical peptidase M48 like-protein
LocalisationMembrane
Molecular mass (Da)32426.4
Isoelectric point11.04
Gene length (bp)933
Protein length311
Location (kb)6141.19


Functional categorycell wall and cell processes


Coordinates
TypeStartEndOrientation
CDS61402556141187-


Protein sequence in FASTA format
>M. marinum M | MMAR_5059
MNAALLLFAYASALIWVGPVLLRRVTGTGVHPRLAVASWLSAVFAAIAAWVGALVFLGAAVLDSIWRHRALALCLKELGL
AGELGLPRGIASALAVGVLSTGAVATVIACWRMGRQLRRQRSASRLHAATARTIGGASDWPGVVVVPAPQPAAYCVTGRP
NSVIVVTSGALGRLDEPQLAAVLAHEYAHLASRHHDLLMALRALASSLPRLPLFAAAAKVVADLLEMCADDVAVRSHGKM
ALLRGLLALTEGPAMAPAALGAANTATVARAERLAISVSRRSWWQERLMLWATIGLAVVSPMILGLACRL*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Gene Ontologymetalloendopeptidase activity
proteolysis
zinc ion binding
membrane
UniProtB2HJ00