Quick Search

Enter gene name or accession number


Gene: MMAR_5316

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nametcrY
Accession numberMMAR_5316
TypeCDS
Functionsensor part of a two component regulatory system.
Producttwo component sensor kinase TcrY
LocalisationMembrane
Molecular mass (Da)53721.4
Isoelectric point6.97
Gene length (bp)1515
Protein length505
Location (kb)6424.2


Functional categoryregulatory proteins


Coordinates
TypeStartEndOrientation
CDS64226896424203-


Protein sequence in FASTA format
>M. marinum M | tcrY
MSSNRLVRRPGAWSLRLRLLVGQILVLAVVCVGITAATELALHHHLVAQLDGQLGGTSHRSALMYPESSHRFWRHQHRYW
RPGPGPRFLDAPGQPAGMVGAVVRDGKAIVAGYLTNSGDRAEISPTAQAQLAAVAGSQDPVTLNLDGLGRYRVVSALSRR
GDELIVTGLSMSDVDATMIRMLIIFGIVTIVALVAATTAGAIIIRRALAPLRRVAQTATEVVDLPLDRGEVELPVRVSET
DANPDTEVGQLGSALNRMLDHIAAALSTRQASETRVRQFVADASHELRTPLAAIRGYTELAQRMGDDRAAVAHAMSRVGS
ETERITSLVEDLLLLARLDSGRPLEREPVDMSRLAVDAVSDAHVAGPDQQWELDLPAEPVVVTGDAARLHQVVANLLANA
RIHTGPGAVVTTRLSSGPTHVVLEVIDNGPGIPEAMQSEIFERFARGDTSRSRKGGSTGLGLAIVAAVVKAHNGTITVNS
SPGRTEFVVRLPLDAWQRSGVPPG*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
Enzyme Classification2.7.13.3
Gene Ontologytwo-component sensor activity
two-component signal transduction system (phosphorelay)
ATP binding
integral to membrane
peptidyl-histidine phosphorylation
MtuberculosisRv3764c
UniProtB2HLI8