Quick Search

Enter gene name or accession number


Gene: MSMEG_0786

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMSMEG_0786
Accession numberMSMEG_0786
TypeCDS
FunctionUNKNOWN
Productserine/threonine protein kinase
Commentsidentified by match to protein family HMM PF00069
Molecular mass (Da)82644.5
Isoelectric point5.0267
Gene length (bp)2283
Protein length760
Location (kb)874.298


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS872016874298-


Protein sequence in FASTA format
>M. smegmatis MC2-155 | MSMEG_0786
MTSPENPDLPDADDAYVDSGPGTQPASLEDLDMDSASTMRPMATQAVYRPEFDDTDGTSRGTVVTEAYDQVTMATRALSP
MRRLGGGLVEIPRVPERDPLTALMTNPVVAESKRFCWNCGKPVGRSTPDGRALSEGWCPHCGSPYSFLPQLSPGDIVADQ
YEIKGCIAHGGLGWVYLAFDKNVNDRPVVLKGLVHSGDAEAQAIAMAERQFLAEVTHPGIVKIYNFVEHEDKHGNPVGYI
VMEYVGGTSLKQARGAKLPVAEAIGYMLEILPALGYLHSIGLAYNDLKPENIMITEEQLKLIDLGAVSRLNSYGYLYGTP
GYQAPEIVRTGPTVATDIYTVGRTLAALTLSLRTRRGRYVDGLPSDDPVLETYDSYHRLLRRAIDPDPRRRFTSAEEMSS
QLLGVLREVVATDTGVPRPGLSTVFSPSRSTFGVDLLVAHTDVYVDGQVHSEKLTAQEIVRALPVPLVDRTDVGAPMLVA
SVLSEPVHTLDQLRAARHGALDTEGIDLNESVELPLMEVRALLDLGDVAKATRKLEDLAARVGWRWRLVWFKAVSEMLSA
DYDSATKHFTEVLDTLPGELAPKLALAATAELAGTADELKFYKTVWSTDNGVISAGFGLARAQSVAGERDMAVQTLDEVP
PTSRHFTTARLTSAVTLLSGRSTSEITEQHIRDAARRVEALPDSEPRVLQIRALVLGTALDWLADNTASSNHILGFPFTE
HGLKLGVEASLRALARIAPTQSHRYALVDLANSVRPMSTF
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Gene Ontologyprotein serine/threonine kinase activity
ATP binding
protein amino acid phosphorylation
MtuberculosisRv0410c
UniProtA0QQK3