Quick Search

Enter gene name or accession number


Gene: MSMEG_0937

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameregX3
Accession numberMSMEG_0937
TypeCDS
FunctionUNKNOWN
ProductDNA-binding response regulator RegX3
Commentsidentified by similarity to SP:Q50447; match to protein family HMM PF00072; match to protein family HMM PF00486
Molecular mass (Da)24624.1
Isoelectric point4.5378
Gene length (bp)678
Protein length225
Location (kb)1017.76


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS10177641018441+


Protein sequence in FASTA format
>M. smegmatis MC2-155 | regX3
MLIVEDEESLADPLAFLLRKEGFEATVVGDGPSALAEFERSGADIVLLDLMLPGMSGTDVCKQLRARSSVPVIMVTARDS
EIDKVVGLELGADDYVTKPYSARELIARIRAVLRRGADNDDAGADDGVLEAGPVRMDVERHVVSVNGEPITLPLKEFDLL
EYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEEDPANPVHLVTVRGLGYKLEG
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Gene Ontologytwo-component response regulator activity
two-component signal transduction system (phosphorelay)
DNA binding
transcription
regulation of transcription, DNA-dependent
MtuberculosisRv0491
UniProtQ9F868