Quick Search

Enter gene name or accession number


Gene: MSMEG_0943

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameproC
Accession numberMSMEG_0943
TypeCDS
FunctionUNKNOWN
Productpyrroline-5-carboxylate reductase
Commentsidentified by match to protein family HMM PF03807; match to protein family HMM TIGR00112
Molecular mass (Da)28989
Isoelectric point4.5706
Gene length (bp)861
Protein length286
Location (kb)1023.18


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS10231801024040+


Protein sequence in FASTA format
>M. smegmatis MC2-155 | proC
MSRIAIIGGGSMGEALLSGLLRAGRQVKDMVVAEKFPERAKYLADKYSVRVTSVADAAENAHYVVVAVKPADVEKVIGEI
AEAAANAETDTAEQVFVTIAAGVGTAYYEAKLPAGSPVIRVMPNAPVIVGGGVSALAPGRFATPEQLKEVSTLFDAVGGV
ITVSESQLDAVTALSGSGPAYFFLMAEAMVDAGVAVGLSRAVATDLVAQTMAGSAAMLLDRLDQVNAAGGAALDTTPAQL
RATVTSPAGTTAAGLRELERGGLRAAVANAVEAAKTRSEQLGITSE
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Enzyme Classification1.5.1.2
Gene Ontologypyrroline-5-carboxylate reductase activity
proline biosynthetic process
oxidation reduction
MtuberculosisRv0500
UniProtA0QR08