Quick Search

Enter gene name or accession number


Gene: MSMEG_1311

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMSMEG_1311
Accession numberMSMEG_1311
TypeCDS
FunctionUNKNOWN
Productoligopeptide transporter, OPT family protein
Commentsidentified by match to protein family HMM PF03169; match to protein family HMM TIGR00728; match to protein family HMM TIGR00733
Molecular mass (Da)68708
Isoelectric point8.9286
Gene length (bp)1992
Protein length663
Location (kb)1406


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS14040051405996-


Protein sequence in FASTA format
>M. smegmatis MC2-155 | MSMEG_1311
MTSESTATPATPTLRELTVRGILLGGVITLVFTAANVYLGLKVGLTFATAIPAAVISMAILRNFRDHSIVENNIVQTVAS
AAGTLSAIIFVLPGLVMIGWWTGFPYWITVAVCAVGGILGVMYSIPLRRALVTGSDLPYPEGVAAAEVLKVGERTEGAED
NRIGLRIITFGSIVSVAFALLANLKVLANSITAYFRVGAGGSMFGASLSFALIGVGHLVGMTVGIAMLVGLVISFGIILP
FRTIGDFAGSESVADVISSAFANEVRFVGAGAIAVGAVWTLLKILRPIVKGITEALVSARERREGQLVDITQRDIPFPIV
VATIVVMLLPIAVLLWEFSRGTVLQGSSAGIIVASVVFVFVIGLVIAAVCGYMAGLIGSSNSPISGVGILTVLIAALLIK
IVFGPTNDDQATALVAFTLFAAAITFGVATISNDNLQDLKTGQLVGATPWKQQVALVIGVLFGSAIIPPVLELMQTAFGF
LGAPGASENALAAPQAALISSLAKGVFGGSLDWSLIGLGAAIGVVVVIIDEILHRTSRFALPPLAVGMGMYLPMSLILVI
AIGAVIGYVYNRWAIRTGGDVQRKKRLGVLLATGLIVGESLYGVVFAGIVAGTGNEDPLAIFTGNDGNFAQIFGIVAFAA
VILWLYKRTQTLSSREVGAKSGQ
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Gene Ontologytransmembrane transport
MtuberculosisRv2395
UniProtA0QS13