Quick Search

Enter gene name or accession number


Gene: MSMEG_1918

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMSMEG_1918
Accession numberMSMEG_1918
TypeCDS
FunctionUNKNOWN
Productsensor histidine kinase
Commentsidentified by match to protein family HMM PF02518; match to protein family HMM PF07568
Molecular mass (Da)53695.1
Isoelectric point5.7293
Gene length (bp)1500
Protein length499
Location (kb)1998.48


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS19984761999975+


Protein sequence in FASTA format
>M. smegmatis MC2-155 | MSMEG_1918
MSTLGDLLAEHTMLPGSAVDHLHAVVGEWQMLSDLSFADYLMWVRRDDGVLVCVAQIRPNTAPTVLLADSVGKLAGPDDL
PVVTMAFESGAIGRGSDKAGQGSRTRPGLDVEAVPVRHQGQVVAVLTHQTALAERRLTSPLEGAYLDCANDLLHMLAEGT
FPNIGDLAMSRSSPRVGDGFIRLNEGGEVVFASPNAISAYHRMGLNSELDGHNLVAITRPLISDPFEAQELANHIRDSLA
GGSSMRMEVDANGAAILLRTLPLVAGGKSLGAAVLIRDVTEVKRRDRALLSKDATIREIHHRVKNNLQTVAALLRLQARR
TSNEEAREALIESVRRVTSIALVHDALSMSVDEEVNLDQVVDRILPIMNDVASVDTPIRINRVGNLGVLDADRATALIMV
ITELVQNAIEHAFDAKTEQGCVTIKAERSARWLDVVVHDDGRGLPVGFSLEKSDRLGLQIVRTLVTAELDGSLGMHDVPS
GGTDVVLRVPIGRRSRGAQ
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Gene Ontologytwo-component sensor activity
ATP binding
signal transduction
peptidyl-histidine phosphorylation
MtuberculosisRv3220c
UniProtA0QTP6