Quick Search

Enter gene name or accession number


Gene: MSMEG_3076

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameggt
Accession numberMSMEG_3076
TypeCDS
FunctionUNKNOWN
Productgamma-glutamyltransferase
Commentsidentified by match to protein family HMM PF01019; match to protein family HMM TIGR00066
Molecular mass (Da)66411.1
Isoelectric point4.9514
Gene length (bp)1911
Protein length636
Location (kb)3150.13


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS31482163150126-


Protein sequence in FASTA format
>M. smegmatis MC2-155 | ggt
MLIASGCSDGAERPRRPAPGPCEIVSNGTPVPKTPESPPPPPGAPAGRDIATQPEVATGYRTDMTAVRTATYAVATANPL
ATEAACKVLRDGGTAADALITAQAVLGLVEPQASGLGGGGFLLYHDAATGAVRAFDGRETAPAAATENYLRWISEADRTE
PRPDARASGRSIGVPGIVRLLDVVHREYGKKAWRELFDPAVNLADRGFDISPRLAAALLDAAPQLRLDPEASAYFLNQDG
TPKRVGTRLTNPAYAKTLGAIATDGADAFYTGDIARAIVAAAADTSGGRTPSLLTENDLATYTVKTRDPLCTTYRGREIC
GMPPPSSGGIAVAATLGILEHFAMKQHRPTDLDRNGGHPTVMGVHLISEAERLAYADRDRYVADTDFVALPGGSPNTLLD
SAYLTGRAALISEDRTMGTAQPGSFGPPVTAAPVREHGTSQVSIIDSFGNAAALTTTVESAFGSFHMVDGFLLNNQLTDF
SAEPVSPEGTPIPNRVEPGKRPRSTMAPTLIFDHDGGERGPLYAVLGSPGGSVIIQFVVKTVVGLLDWGLDPQQAVSMVD
FGAANTPKTNVGGEHPNVDTSDNGDHDPLVRGLRRLGHDVNLDDQSSGLSAIARTESGWIGGADPRREGLVMGDPG
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Enzyme Classification2.3.2.2
Gene Ontologygamma-glutamyltransferase activity
acyltransferase activity
MtuberculosisRv2394
UniProtA0QWV4