Quick Search

Enter gene name or accession number


Gene: MSMEG_3205

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namehisD
Accession numberMSMEG_3205
TypeCDS
FunctionUNKNOWN
Producthistidinol dehydrogenase
Commentsidentified by match to protein family HMM PF00815; match to protein family HMM TIGR00069
Molecular mass (Da)46702.6
Isoelectric point5.0525
Gene length (bp)1338
Protein length445
Location (kb)3284.2


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS32842003285537+


Protein sequence in FASTA format
>M. smegmatis MC2-155 | hisD
MNMMAKFQMSRIDLRNRVLSAAQLRSALPRGGVDVDAVVPKVRPIVDAVAQRGAQAALEYGESFDGIRPETVRVPRELLS
QALENLDADVRAALQVSIDRARAVHADQRRTDTTTTLAPGATVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQTAGV
DSMVIASPPQGQFGGRPHPTILAAAALLGVDEVWAVGGAQAVALLAYGGTDTDGAELAPVDMITGPGNIYVTAAKRICRS
QVGIDAEAGPTEIAILADHTADPVHVAADLISQAEHDEMAASVLVTDSETLAEATDRELANQLATTKHVERVTAALSGKQ
SAIVLVDDIDAGVRTVNAYAAEHLEIQTVDAPGVAGRIRSAGAIFVGAWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQ
TFLRGIHVVEYDEAALKDVSGHVITLSKAEDLPAHGEAVRRRFER
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Enzyme Classification1.1.1.23
Gene Ontologyhistidine biosynthetic process
histidinol dehydrogenase activity
zinc ion binding
NAD or NADH binding
oxidation reduction
MtuberculosisRv1599
UniProtA0QX81