Quick Search

Enter gene name or accession number


Gene: MSMEG_3944

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMSMEG_3944
Accession numberMSMEG_3944
TypeCDS
FunctionUNKNOWN
Producttwo component transcriptional regulatory protein devr
Commentsidentified by match to protein family HMM PF00072; match to protein family HMM PF00196
Molecular mass (Da)23935.5
Isoelectric point5.6157
Gene length (bp)654
Protein length217
Location (kb)4013.79


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS40137884014441+


Protein sequence in FASTA format
>M. smegmatis MC2-155 | MSMEG_3944
MVTVFLVDDHELVRRGLIDLVRSDPDLDVIGEAGSVSEAMARIPALRPEVAVLDVRLPDGNGIELCRDLLSRLPDLRCLM
LTSFTSDEATLDAILAGASGFVIKDIKGMDLTHAIKEVAAGHSLLDNRAAAALMKRLRETASHSDPLTGLSDQERMLLEL
LGEGLTNKQIAERMFLAERTVKNYVSRLLAKLGMERRTQAAVFISKLDHGRHHDEQY
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Gene Ontologytwo-component response regulator activity
two-component signal transduction system (phosphorelay)
transcription factor activity
intracellular
transcription
regulation of transcription, DNA-dependent
sequence-specific DNA binding
MtuberculosisRv3133c
UniProtA0QZ95