Quick Search

Enter gene name or accession number


Gene: MSMEG_4258

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nametrpD
Accession numberMSMEG_4258
TypeCDS
FunctionUNKNOWN
Productanthranilate phosphoribosyltransferase
Commentsidentified by match to protein family HMM PF00591; match to protein family HMM PF02885; match to protein family HMM TIGR01245
Molecular mass (Da)37518.3
Isoelectric point5.1765
Gene length (bp)1095
Protein length364
Location (kb)4344.15


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS43430554344149-


Protein sequence in FASTA format
>M. smegmatis MC2-155 | trpD
MTSGPSQPFPSASGPDDGPSWPRILGRLTTGQNLPNGHAAWAMDQIMTGAATPAQISGFAVSMKMKRPTASEVRELADIM
LTHARRVPTDEIGTDTVDIVGTGGDGANTVNLSTMASIVVAACGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDDVA
RSVREVGIGFAFAPQFHPSYKHASIVRREIGVPTVFNLLGPLTNPAGPRAGLIGCAWADLAEVMAGVFAARGSSVLVVHG
DDGLDELTTTTTSTIWRVQGGTMERLTFDPAAFGFKRAEISELVGGDASENAAEARAVLGGAKGPVRDAVVLNAAGAMVA
HAGLASDAQWLPAWEAGLARAVEAIDSGAAEQLLARWVRFGQQL
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Enzyme Classification2.4.2.18
Gene Ontologytryptophan biosynthetic process
anthranilate phosphoribosyltransferase activity
MtuberculosisRv2192c
UniProtA0R048