Quick Search

Enter gene name or accession number


Gene: MSMEG_4309

General annotation | Coordinates | Sequence | Genome Browser | Orthologs/Cross-references


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene nameMSMEG_4309
Accession numberMSMEG_4309
TypeCDS
FunctionUNKNOWN
ProductLow molecular weight protein-tyrosine-phosphatase
Commentsidentified by match to protein family HMM PF01451
Molecular mass (Da)17719.8
Isoelectric point4.8646
Gene length (bp)492
Protein length163
Location (kb)4399.26


Functional categoryunknown


Coordinates
TypeStartEndOrientation
CDS43992584399749+


Protein sequence in FASTA format
>M. smegmatis MC2-155 | MSMEG_4309
MSELHVTFVCSGNICRSPMAEKMFAHQIAERGLRDVVRVTSAGTGSWHAGDGADERACLVLADRGYPTAHRAAVVDDDHL
SADLVVAMGRNHARILADLGVEPDRLRMLRSFDPRAGAHTPDVEDPYYGTRDDFEAVFEVIEAALPGLHDWVDEALAARG
IVA
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
Enzyme Classification3.1.3.48
Gene Ontologyprotein tyrosine phosphatase activity
protein amino acid dephosphorylation
MtuberculosisRv2234
UniProtA0R098